PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g027310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-PHD
Protein Properties Length: 728aa    MW: 80443.9 Da    PI: 4.6073
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g027310.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.83.4e-12620665853
                     -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     t+  +++L   F++n+yp+++++e LAk+l++t  qV++WF+ rR+
  Csa15g027310.1 620 TDPKTQRLYISFQENQYPDKATKESLAKELQMTIMQVSNWFKHRRY 665
                     5567899999***********************************7 PP

2PHD38.42.8e-13268323151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C +     +++++lCdg C++ fH++Cl+++l+++++p +  +wlC+ C++k
  Csa15g027310.1 268 FCAKCASkdLSVDNDIILCDGfCDRGFHQYCLEPPLQKDDIPPDdeSWLCPGCDCK 323
                     699999955455********88*******************99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579034.21E-13259323IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.108.0E-13265322IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.074266323IPR019787Zinc finger, PHD-finger
CDDcd155041.02E-26268320No hitNo description
PfamPF006281.0E-10268323IPR019787Zinc finger, PHD-finger
SMARTSM002491.6E-8268321IPR001965Zinc finger, PHD-type
PROSITE patternPS013590269320IPR019786Zinc finger, PHD-type, conserved site
SMARTSM003899.1E-9610674IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-12613664IPR009057Homeodomain-like
SuperFamilySSF466891.37E-11618665IPR009057Homeodomain-like
CDDcd000865.05E-11620665No hitNo description
PROSITE profilePS5007112.017620670IPR001356Homeobox domain
PfamPF000461.2E-9620665IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MNGAAFKRVT RSSTSGLKQI NVDSGVEVNN PTVVNVSEQG NASVPLKPSE AGIQMPNDAN  60
GVRDNRKGKE VQKPTPQTGK KRSNTKTKFS GSYRELVIGL PCRGQFEIQR SRSSKSSKRL  120
GGGGERNVLF SSHKSAQRSK DAAAGSSSVA ANNTPVGSRP RKRNKTTKKG EVREDDEYTR  180
IKKKLRYLLK RINYEQNLID AYSLEGWRRS SVEKLRPEKE LERATKEILR CKVKIRDLFQ  240
HLDTLCAEGS LPVSLFDSDG AISSDDIFCA KCASKDLSVD NDIILCDGFC DRGFHQYCLE  300
PPLQKDDIPP DDESWLCPGC DCKDDSLDLL NDSLGTKLSV SDSWEKIFPE AAAALAGGGQ  360
NLNCDLPSDD SDDEEYDPDG VNDNENDEDN SDDSDESENE DDISDFTSAS DEMIESFKEG  420
KDIMADIMAL PSDDSEDDDY DPEAPTRDED ETQESSNSDC TSDSEDIETS FKGNESNQQD  480
KVTPPEDPGR KKSQLPYDAI SESDAVLDDG LAGVPRRRNV ERLDYKKLYD EEYENAPSSS  540
SDDDDWDKTA RIGKKDSESE DEGDTVPLKQ SSNAEDHTSE KPRPKSKRAS KKDTLEVPQQ  600
GPGENGCSGE KISSTAYKQT DPKTQRLYIS FQENQYPDKA TKESLAKELQ MTIMQVSNWF  660
KHRRYVNSKP VVSEEAVEKS KKGKEGECGR SVAGSSKQTT METESVAGNK SVASASTSPG  720
SRKRRRR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179185RIKKKLR
2721725RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1171050.0AK117105.1 Arabidopsis thaliana At3g19510 mRNA for putative homeobox protein HAT3.1, complete cds, clone: RAFL16-64-G01.
GenBankBT0059650.0BT005965.1 Arabidopsis thaliana At3g19510 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010466095.10.0PREDICTED: homeobox protein HAT3.1-like
RefseqXP_010466096.10.0PREDICTED: homeobox protein HAT3.1-like
RefseqXP_010466097.10.0PREDICTED: homeobox protein HAT3.1-like
SwissprotQ049960.0HAT31_ARATH; Homeobox protein HAT3.1
TrEMBLR0G2870.0R0G287_9BRAS; Uncharacterized protein
STRINGAT3G19510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72702543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.10.0Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain